UndergroundScene Forums  

Welcome to the UndergroundScene Forums forums.

You are currently viewing our boards as a guest which gives you limited access to view most discussions and access our other features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload content and access many other special features. Registration is fast, simple and absolutely free so please, join our community today!


Go Back   UndergroundScene Forums > SPECIAL AREAS > The Lounge > Bollocks
Reload this Page Come and see my brothers band.
Register FAQ Site Areas Gig Guides Members Calendar Arcade Mark Forums Read

Reply
 
LinkBack Thread Tools Display Modes
Old 21st May 2003, 02:42 PM   #1 (permalink)
J-a-n-i-o
Registered User
 
J-a-n-i-o's Avatar
 
Join Date: Feb 2003
Location: GlAsGoW
Posts: 19
J-a-n-i-o is an unknown quantity at this point
Cool Come and see my brothers band.
Right well, I know I shouldn't really be posting this here but aye. My brothers band Japan 4, are playing with Pencil Head, My Own Religion and Pysco Dalek or whatever it is on the 12th of June (Cleveden Secondary). So go on, it's there first gig . Tickets are also a bargain at £4.
Anyway, I've still not been to see you guys yet. Jeeez.
J-a-n-i-o is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 12:27 AM   #2 (permalink)
Ross
Senior Member
 
Ross's Avatar
 
Join Date: Oct 2002
Location: Lenzieshire
Posts: 3,613
Ross can only hope to improve
Pyscho Dalek! That was the band on the BBC documentary that went 'if yer no oor mates, ye can fuck oaf the noo'! I'm there!
Ross is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 07:45 AM   #3 (permalink)
J-a-n-i-o
Registered User
 
J-a-n-i-o's Avatar
 
Join Date: Feb 2003
Location: GlAsGoW
Posts: 19
J-a-n-i-o is an unknown quantity at this point
Quote:
Originally posted by Bonnie Prince Miko
Pyscho Dalek! That was the band on the BBC documentary that went 'if yer no oor mates, ye can fuck oaf the noo'! I'm there!
See you there man wahahaaa
J-a-n-i-o is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 07:37 PM   #4 (permalink)
ian_likes_stuff
Registered User
 
ian_likes_stuff's Avatar
 
Join Date: Mar 2003
Location: Glasgow
Posts: 331
ian_likes_stuff is on a distinguished road
Japan 4!!! please say that's from the Tom Green movie
ian_likes_stuff is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 09:17 PM   #5 (permalink)
J-a-n-i-o
Registered User
 
J-a-n-i-o's Avatar
 
Join Date: Feb 2003
Location: GlAsGoW
Posts: 19
J-a-n-i-o is an unknown quantity at this point
Quote:
Originally posted by ian_likes_stuff
Japan 4!!! please say that's from the Tom Green movie
Yas, you got it in one!
Freddie Got Fingered.
J-a-n-i-o is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 09:20 PM   #6 (permalink)
aunt gary
Senior Member
 
aunt gary's Avatar
 
Join Date: Jan 2003
Location: Dundee
Posts: 7,351
aunt gary will become famous soon enoughaunt gary will become famous soon enoughaunt gary will become famous soon enoughaunt gary will become famous soon enoughaunt gary will become famous soon enough
Hey there sports fans

thats exactly wot I woz gonna say.

Chow ding
aunt gary is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 09:21 PM   #7 (permalink)
J-a-n-i-o
Registered User
 
J-a-n-i-o's Avatar
 
Join Date: Feb 2003
Location: GlAsGoW
Posts: 19
J-a-n-i-o is an unknown quantity at this point
Quote:
Originally posted by aunt gary
Hey there sports fans

thats exactly wot I woz gonna say.

Chow ding
Good stuff.
J-a-n-i-o is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 22nd May 2003, 10:30 PM   #8 (permalink)
ian_likes_stuff
Registered User
 
ian_likes_stuff's Avatar
 
Join Date: Mar 2003
Location: Glasgow
Posts: 331
ian_likes_stuff is on a distinguished road
fantastic film, I could watch it again and again......which i have
ian_likes_stuff is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 23rd May 2003, 12:27 PM   #9 (permalink)
Ross
Senior Member
 
Ross's Avatar
 
Join Date: Oct 2002
Location: Lenzieshire
Posts: 3,613
Ross can only hope to improve
nabrut
Ross is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 23rd May 2003, 02:34 PM   #10 (permalink)
ian_likes_stuff
Registered User
 
ian_likes_stuff's Avatar
 
Join Date: Mar 2003
Location: Glasgow
Posts: 331
ian_likes_stuff is on a distinguished road
the juxtaposition of that picture and that word are amusing.

juxtaposition is a big fuck-off word isn't it?
ian_likes_stuff is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 23rd May 2003, 03:25 PM   #11 (permalink)
Freto
Senior Member
 
Freto's Avatar
 
Join Date: Feb 2003
Location: Glasgow
Posts: 1,528
Freto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enough
I had a juxtaposition once but i went to see the doctor about it and he gave me some ointment and now its better.
Freto is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 23rd May 2003, 05:19 PM   #12 (permalink)
Lindsay
eighties fan
 
Join Date: Dec 2002
Location: Glasgow
Posts: 7,594
Lindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud ofLindsay has much to be proud of
haha
Lindsay is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 26th May 2003, 09:59 AM   #13 (permalink)
Ross
Senior Member
 
Ross's Avatar
 
Join Date: Oct 2002
Location: Lenzieshire
Posts: 3,613
Ross can only hope to improve
antidisestablishmentareanism


Now that's a fuck-off word
Ross is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 15th March 2005, 10:47 AM   #14 (permalink)
Unregistered
 
Posts: n/a
Cool A dock-off crazy mowfower word
This word is real - its a name for some amino acid or something:

Kyyhkyslakkahillotaatelipalmusunnuntaikävelykatuju hlakoristehedelmäkaramellimassatuotevalvontalaitte istotestauslaboratoriokäyttökertatulitikkuviinapii lohomokaasulasersädehoitokotikaljakimblemestaruuss arjakuvaristikkokilpajuoksuhiekkaaavikkoluontoohje lmauusintavaalikokousedustusmenopaluuruuhkabussivu oropysäköintisakkolihakoukkuselkänahkavyöruusukasv imaamunajuustomaitorasvaimunestepintaalahuulipunak ampelaverkkomahalaskuharjoituskrapulaaamukampapell avaöljykriisiapukeinolonkkalepolomarusketusrajatie toteollisuuskiinteistömarkkinointidiplomiinsinööri opiskelijaperinnemaisemaarkkitehtikiltaaktiivihiil iteräsbetonivalurautaristisiitoshärkäpizzamaustevo ipaperiroskapostimerkkisavusaunavastaprotestimarss ivapautusliikevaihtoväliarvojoukkopakomatkaopaskoi rakantakorttitaikatalvisotakunniajäsenetupuolikuiv arehuviljaaittakorpisuomaastohiihtoputkitiivistesi likonirintataskuvaraslähtöliukumiinakenttäkeitinve sihanasaariryhmätyömyyrävuosikurssikirjapainopiste tulotukivarsikenkäkauppaopistoupseerikerhohuonepal veluammattikoulupoikatyttöenergiatalousaluelaajenn ustarvehierarkiakaaviosuunnittelupäätöspäivävienti sulkuporttiteoriapohjakuntourheiluruutuässäparilui stelutyylituomaripelimiesvoimisteluvideokulmakarva kuonokoppalakkipäämääräalennustilataksimittarimato purkkikeittoastiakaappipakastinyhdistelmälukkosepp ähenkilötunnussanaleikkikalupakkipussieläinkoeponn istuslautakuntalakitekstiseikkailuleiritelttakanga spuujalkasienipiirakkareseptivihkopakkausmuovikuul aruiskumaalaustarvikevarastohyllymetrilakuavainnau lakkovartiopäällikkötasogeometriavirhevaihtosähkök azoopillihousupukupellehyppylankakeräkaaliaivovuot osuojavaatekappalemyyntitykkilavatanssiaskelmootto ripyöräkoppisiemenperunapalstajakoviivaintegraalio peraattorialgebraoppilaitoskompleksilukusuoravetoo ikeusmurhaasevarikkopilttuu.
 
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Old 15th March 2005, 09:08 PM   #15 (permalink)
Freto
Senior Member
 
Freto's Avatar
 
Join Date: Feb 2003
Location: Glasgow
Posts: 1,528
Freto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enoughFreto will become famous soon enough
is that not the name of the greek defender who plays for Rangers?
Freto is offline  
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Reply

« Previous Thread | Next Thread »

Thread Tools
Display Modes
Linear Mode Linear Mode

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts
vB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On




All times are GMT. The time now is 09:18 AM.

Contact Us - UndergroundScene.co.uk - Archive - Top

Powered by vBulletin
UndergroundScene.co.uk is bad-ass and under copyright

Content Relevant URLs by vBSEO 3.0.0 RC8